General Information

  • ID:  hor004565
  • Uniprot ID:  Q07892
  • Protein name:  Eclosion hormone
  • Gene name:  Eh
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  Insect eclosion hormone family
  • Source:  animal
  • Expression:  Expressed in a single pair of brain neurons which extend their processes the entire length of the central nervous system and also to the corpora cardiaca portion of the ring gland. These cells show massive depletion of immunoreactive Eh at ecdysis.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0008031 eclosion hormone activity; GO:0008255 ecdysis-triggering hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007562 eclosion; GO:0007563 regulation of eclosion; GO:0018990 ecdysis, chitin-based cuticle
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  LVHFGNALPAISHYTHKRFDSMGGIDFVQVCLNNCVQCKTMLGDYFQGQTCALSCLKFKGKAIPDCEDIASIAPFLNALE
  • Length:  80
  • Propeptide:  MNCKPLILCTFVAVAMCLVHFGNALPAISHYTHKRFDSMGGIDFVQVCLNNCVQCKTMLGDYFQGQTCALSCLKFKGKAIPDCEDIASIAPFLNALE
  • Signal peptide:  MNCKPLILCTFVAVAMC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuropeptide that triggers the performance of ecdysis behaviors at the end of a molt. It triggers adult behavior patterns: larval, pupal and adult ecdysis, and plasticization during the molt.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  31-55; 35-51; 38-66
  • Structure ID:  AF-Q07892-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004565_AF2.pdbhor004565_ESM.pdb

Physical Information

Mass: 1017955 Formula: C390H604N102O112S8
Absent amino acids: W Common amino acids: LA
pI: 6.74 Basic residues: 9
Polar residues: 25 Hydrophobic residues: 30
Hydrophobicity: 20.88 Boman Index: -5549
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 86.63
Instability Index: 3384.75 Extinction Coefficient cystines: 3355
Absorbance 280nm: 42.47

Literature

  • PubMed ID:  8344291
  • Title:  Isolation, Characterization and Expression of the Eclosion Hormone Gene of Drosophila Melanogaster